PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01404.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 251aa    MW: 28805.2 Da    PI: 4.3442
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01404.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix51.23.3e-161181614387
          trihelix  43 ferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                        ++s+  Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Migut.L01404.1.p 118 HQKSARCCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 161
                       4799************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF483711.96E-52459IPR016024Armadillo-type fold
PfamPF138372.3E-10116162No hitNo description
SuperFamilySSF483711.96E-5125148IPR016024Armadillo-type fold
SuperFamilySSF483711.96E-5198228IPR016024Armadillo-type fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005488Molecular Functionbinding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MELDMDTRIN IGCSAGVYMS AAKELIEKLQ NAIAEAKTEL EKYFNVSALL KHMPTQPPQP  60
VKYMIEKGNY GDEETLTVEK MFMYMEIDRI IAAMYTQHKE QVAKVHQMTN LANYLLTHQK  120
SARCCKEKWE NINKYFKKVK ESNKKRPEDS KTCPYFHQLD AIYRERGSKS DVVSFPGYGL  180
NPDDNNPMML PPPIMARPEQ FQDNESDQDD EEDDVDGDED DEDDEEDEAQ CFEIVINKQQ  240
SSVTTTNAAD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1825621e-162AC182562.2 Erythranthe guttata clone MGBa-38M20, complete sequence.
GenBankAC1825651e-162AC182565.2 Erythranthe guttata clone MGBa-47F23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853467.14e-60PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor GT-2-like
TrEMBLA0A022QRB41e-116A0A022QRB4_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-24Trihelix family protein